PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00987.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28019.6 Da    PI: 6.8905
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00987.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.1e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtf+kRrng+lKKA+ELS LCdaeva+iifs +g+l+e+ss
  Pahal.I00987.2  9 KRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSS 59
                    79***********************************************96 PP

2K-box95.48.9e-328917217100
           K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      +q++ kLk ++e Lq++qR++lGedL++Ls+keL+qLe+q+e slk+iR++Kn++ll+q+ +l+ ke+elq+ nk+Lrkkl+e
  Pahal.I00987.2  89 NYQDYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEISLKHIRTRKNQMLLDQLFDLKSKEQELQDLNKDLRKKLQE 172
                     689******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.52161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-39160IPR002100Transcription factor, MADS-box
CDDcd002652.96E-42278No hitNo description
SuperFamilySSF554551.12E-31279IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.41486176IPR002487Transcription factor, K-box
PfamPF014867.0E-2689171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSLLCD AEVALIIFSG RGRLFEFSSS  60
SCMYKTLERY RSSNYSSQEV KTPLDGEINY QDYLKLKTRV EFLQTTQRNI LGEDLGPLSM  120
KELEQLENQI EISLKHIRTR KNQMLLDQLF DLKSKEQELQ DLNKDLRKKL QETNAENVLH  180
VSWEEGGHSG ASGNAIEPYQ GFLQHPENDP SLQIGYHQQA YMDQLNNEDM GHPNEHGRSG  240
WI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-239117022101Developmental protein SEPALLATA 3
4ox0_B2e-239117022101Developmental protein SEPALLATA 3
4ox0_C2e-239117022101Developmental protein SEPALLATA 3
4ox0_D2e-239117022101Developmental protein SEPALLATA 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5975190.0AY597519.1 Panicum miliaceum leafy hull sterile 1 (LHS1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985189.11e-175PREDICTED: MADS-box transcription factor 1 isoform X2
SwissprotA2XDY11e-134MADS1_ORYSI; MADS-box transcription factor 1
SwissprotQ10PZ91e-134MADS1_ORYSJ; MADS-box transcription factor 1
TrEMBLC5WSS61e-166C5WSS6_SORBI; Putative uncharacterized protein Sb01g042840
STRINGSb01g042840.11e-166(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.12e-77MIKC_MADS family protein